Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC9 Peptide - middle region

CCDC9 Peptide - middle region

Product Specifications

UniProt

Q9Y3X0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_056418.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSPHLSGAGDTSISDRKSKEWEERRRQNIEKMNEEMEKIAEYERNQREGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCA1 Human Pre-designed siRNA Set A
HY-RS02748 1 Set

CLCA1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
P552-02 free base
T69052-01 25 mg

P552-02 free base

Sign In for Pricing
View Details
P552-02 free base
T69052-02 50 mg

P552-02 free base

Sign In for Pricing
View Details
P552-02 free base
T69052-03 100 mg

P552-02 free base

Sign In for Pricing
View Details
NLRP2 Antibody
orb1238305-01 0.02 mg

NLRP2 Antibody

Sign In for Pricing
View Details
NLRP2 Antibody
orb1238305-02 0.1 mg

NLRP2 Antibody

Sign In for Pricing
View Details