Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC9 Peptide - middle region

CCDC9 Peptide - middle region

Product Specifications

UniProt

Q9Y3X0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_056418.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSPHLSGAGDTSISDRKSKEWEERRRQNIEKMNEEMEKIAEYERNQREGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WYE-687
C08764-5mg 5 mg

WYE-687

Sign In for Pricing
View Details
BCO1 Antibody
orb36791-01 50 µg

BCO1 Antibody

Sign In for Pricing
View Details
BCO1 Antibody
orb36791-02 100 µg

BCO1 Antibody

Sign In for Pricing
View Details
USP15 Protein Vector (Human) (pPM-C-His)
PV059596 500 ng

USP15 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
General Indole 3 Acetic Acid (IAA) ELISA Kit
MBS2000290-01 24 Strip Well

General Indole 3 Acetic Acid (IAA) ELISA Kit

Sign In for Pricing
View Details
General Indole 3 Acetic Acid (IAA) ELISA Kit
MBS2000290-02 48 Well

General Indole 3 Acetic Acid (IAA) ELISA Kit

Sign In for Pricing
View Details