CAND1 Peptide - middle region
CAND1 Peptide - middle region
Product Specifications
Product Name Alternative
TIP120, TIP120A
UniProt
Q86VP6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CAND1 Rabbit Polyclonal Antibody (orb588227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_060918.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YNYDDEDEDENAMDADGGDDDDQGSDDEYSDDDDMSWKVRRAAAKCLDAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882748-500 1x 500 µL
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
