Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLC1 Peptide - middle region

DLC1 Peptide - middle region

Product Specifications

Product Name Alternative

HP, ARHGAP7, STARD12, p122-RhoGAP

UniProt

Q96QB1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLC1 Rabbit Polyclonal Antibody (orb588248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001157743.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKQDLVPGSPDDSHPKDGPSPGGTLMDLSERQEVSSVRSLSSTGSLPSHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-138-5p miRNA Mimic
CMH0103-01 5 nmol

Hsa-miR-138-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-138-5p miRNA Mimic
CMH0103-02 10 nmol

Hsa-miR-138-5p miRNA Mimic

Sign In for Pricing
View Details
Pannexin 1 (PANX1) Recombinant, Rat
156212-01 10 µg

Pannexin 1 (PANX1) Recombinant, Rat

Sign In for Pricing
View Details
Pannexin 1 (PANX1) Recombinant, Rat
156212-02 50 µg

Pannexin 1 (PANX1) Recombinant, Rat

Sign In for Pricing
View Details
Pannexin 1 (PANX1) Recombinant, Rat
156212-03 200 µg

Pannexin 1 (PANX1) Recombinant, Rat

Sign In for Pricing
View Details
RFP Rabbit pAb, Cy7 conjugated
orb2431808 100 µL

RFP Rabbit pAb, Cy7 conjugated

Sign In for Pricing
View Details