Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLC1 Peptide - middle region

DLC1 Peptide - middle region

Product Specifications

Product Name Alternative

HP, ARHGAP7, STARD12, p122-RhoGAP

UniProt

Q96QB1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLC1 Rabbit Polyclonal Antibody (orb588248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001157743.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKQDLVPGSPDDSHPKDGPSPGGTLMDLSERQEVSSVRSLSSTGSLPSHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Procathepsin L ELISA Kit
MBS7258090-01 48 Well

Guinea Pig Procathepsin L ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Procathepsin L ELISA Kit
MBS7258090-02 96 Well

Guinea Pig Procathepsin L ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Procathepsin L ELISA Kit
MBS7258090-03 5x 96 Well

Guinea Pig Procathepsin L ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Procathepsin L ELISA Kit
MBS7258090-04 10x 96 Well

Guinea Pig Procathepsin L ELISA Kit

Sign In for Pricing
View Details
CSF1R, Recombinant, Human, aa20-517, hIgG-His-Tag (CSF1R, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R, Macrophage Colony-Stimulating Factor 1 Receptor)
470224-01 10 µg

CSF1R, Recombinant, Human, aa20-517, hIgG-His-Tag (CSF1R, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R, Macrophage Colony-Stimulating Factor 1 Receptor)

Sign In for Pricing
View Details
CSF1R, Recombinant, Human, aa20-517, hIgG-His-Tag (CSF1R, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R, Macrophage Colony-Stimulating Factor 1 Receptor)
470224-02 20 µg

CSF1R, Recombinant, Human, aa20-517, hIgG-His-Tag (CSF1R, C-FMS, CD115, CSF-1R, CSFR, FIM2, FMS, HDLS, M-CSF-R, Macrophage Colony-Stimulating Factor 1 Receptor)

Sign In for Pricing
View Details