Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP1 Peptide - middle region

RBP1 Peptide - middle region

Product Specifications

Product Name Alternative

CRBP, RBPC, CRBP1, CRBPI, CRABP-I

UniProt

P09455

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBP1 Rabbit Polyclonal Antibody (orb588347) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001124464.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKK

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP9 Rabbit pAb, IRDye 800CW conjugated
orb2887145 100 µL

GTPBP9 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Anti-Zebrafish FZD3A Antibody APC Conjugated
AZA0A8M2B7P5-APC 100 µg/Vial

Anti-Zebrafish FZD3A Antibody APC Conjugated

Sign In for Pricing
View Details
Porcine Inhibin β C ELISA kit
GTR10456881 96 Well

Porcine Inhibin β C ELISA kit

Sign In for Pricing
View Details
Mouse IgG1 Isotype Control
SM20P 0.1 mg

Mouse IgG1 Isotype Control

Sign In for Pricing
View Details
MAT2B Blocking Peptide
33R-3451 100 ug

MAT2B Blocking Peptide

Sign In for Pricing
View Details
PUMA/BBC3 Rabbit Polyclonal Antibody (APC)
orb2593858 100 µg

PUMA/BBC3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details