Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX11 Peptide - middle region

TEX11 Peptide - middle region

Product Specifications

Product Name Alternative

TGC1, TSGA3, SPGFX2

UniProt

Q8IYF3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX11 Rabbit Polyclonal Antibody (orb588372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001003811.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLAKVLRLLATNYLDWDDTKYYDKALNAVNLANKEHLSSPGLFLKMKILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S- (-) -Oxiracetam
286095-01 5 mg

S- (-) -Oxiracetam

Sign In for Pricing
View Details
S- (-) -Oxiracetam
286095-02 10 mg

S- (-) -Oxiracetam

Sign In for Pricing
View Details
S- (-) -Oxiracetam
286095-03 25 mg

S- (-) -Oxiracetam

Sign In for Pricing
View Details
S- (-) -Oxiracetam
286095-04 50 mg

S- (-) -Oxiracetam

Sign In for Pricing
View Details
S- (-) -Oxiracetam
286095-05 100 mg

S- (-) -Oxiracetam

Sign In for Pricing
View Details
Anti-NDUFB8 Antibody Picoband® Fluoro550 Conjugated
A07936-1-Fluoro550 100 µg/Vial

Anti-NDUFB8 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details