Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX11 Peptide - middle region

TEX11 Peptide - middle region

Product Specifications

Product Name Alternative

TGC1, TSGA3, SPGFX2

UniProt

Q8IYF3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX11 Rabbit Polyclonal Antibody (orb588372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001003811.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLAKVLRLLATNYLDWDDTKYYDKALNAVNLANKEHLSSPGLFLKMKILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human ChoKB Polyclonal Antibody
PA85824HU-01 50 µg

Rabbit Anti-Human ChoKB Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ChoKB Polyclonal Antibody
PA85824HU-02 100 µg

Rabbit Anti-Human ChoKB Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ChoKB Polyclonal Antibody
PA85824HU-03 500 µg

Rabbit Anti-Human ChoKB Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human ChoKB Polyclonal Antibody
PA85824HU-04 1 mg

Rabbit Anti-Human ChoKB Polyclonal Antibody

Sign In for Pricing
View Details
SPT20 Rabbit Polyclonal Antibody
JOT-AP04867-01 20 µL

SPT20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SPT20 Rabbit Polyclonal Antibody
JOT-AP04867-02 50 μL

SPT20 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details