Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNRC6B Peptide - middle region

TNRC6B Peptide - middle region

Product Specifications

UniProt

Q9UPQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNRC6B Rabbit Polyclonal Antibody (orb588379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001020014.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STEWKDPKNTGGWNDYKNNNSSNWGGGRPDEKTPSSWNENPSKDQGWGGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADA (Adenosine Deaminase, Adenosine Aminohydrolase, ADA1) (MaxLight 550)
122962-ML550 100 µL

ADA (Adenosine Deaminase, Adenosine Aminohydrolase, ADA1) (MaxLight 550)

Sign In for Pricing
View Details
MGP antibody
FNab05171 100 µg

MGP antibody

Sign In for Pricing
View Details
A-366 1mg
A15969-1 1 mg

A-366 1mg

Sign In for Pricing
View Details
AChRε (B-11) FITC
sc-376747 FITC 200 µg/mL

AChRε (B-11) FITC

Sign In for Pricing
View Details
pSELECT-CGFP-zeo
psetz-cgfp 20 µg

pSELECT-CGFP-zeo

Sign In for Pricing
View Details
LGMN (Legumain, AEP, LGMN1, PRSC1) (PE)
248148-PE 100 µL

LGMN (Legumain, AEP, LGMN1, PRSC1) (PE)

Sign In for Pricing
View Details