Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNRC6B Peptide - middle region

TNRC6B Peptide - middle region

Product Specifications

UniProt

Q9UPQ9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNRC6B Rabbit Polyclonal Antibody (orb588379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001020014.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STEWKDPKNTGGWNDYKNNNSSNWGGGRPDEKTPSSWNENPSKDQGWGGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Phosphotriesterase-related protein (PTER) ELISA Kit
RK13755 96 Tests

Mouse Phosphotriesterase-related protein (PTER) ELISA Kit

Sign In for Pricing
View Details
Msmo1 (NM_080886) Rat Tagged Lenti ORF Clone
RR211446L3 10 µg

Msmo1 (NM_080886) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CDK2 Protein Vector (Rat) (pPM-C-HA)
15696026 500 ng

CDK2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Polyclonal IFT122 Antibody [DyLight 650]
NBP2-97508C 0.1 mL

Rabbit Polyclonal IFT122 Antibody [DyLight 650]

Sign In for Pricing
View Details
SPCS1 ORF Vector (Human) (pORF)
45243011 1.0 µg DNA

SPCS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Slc25a34 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6543207 1.0 µg DNA

Slc25a34 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details