Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FARP1 Peptide - middle region

FARP1 Peptide - middle region

Product Specifications

Product Name Alternative

CDEP, PLEKHC2, PPP1R75, FARP1-IT1

UniProt

Q9Y4F1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FARP1 Rabbit Polyclonal Antibody (orb589116) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001001715.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CPRTDDEDEGRRKRFPTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nexilin Recombinant Protein Antigen
NBP1-92179PEP 0.1 mL

Nexilin Recombinant Protein Antigen

Sign In for Pricing
View Details
APPL (APPL1) (NM_012096) Human Over-expression Lysate
LS026060 100 µg

APPL (APPL1) (NM_012096) Human Over-expression Lysate

Sign In for Pricing
View Details
FMO1 Antibody
MBS5311936-01 0.1 mL

FMO1 Antibody

Sign In for Pricing
View Details
FMO1 Antibody
MBS5311936-02 5x 0.1 mL

FMO1 Antibody

Sign In for Pricing
View Details
ENPP1 Protein Vector (Mouse) (pPM-C-His)
PV175709 500 ng

ENPP1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
PE anti-rat CD4
FC1227 100 Tests

PE anti-rat CD4

Sign In for Pricing
View Details