Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVC Peptide - N-terminal region

EVC Peptide - N-terminal region

Product Specifications

Product Name Alternative

EVC1, EVCL, DWF-1

UniProt

P57679

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EVC Rabbit Polyclonal Antibody (orb55773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001293019.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRAGRQRTRHQKDDTQNLLKNLESNAQTPSETGSPSRRRKREVQMSKDKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dlk2 siRNA Oligos set (Mouse)
18289174 3x 5 nmol

Dlk2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
RLN3 AAV Vector (Human) (CMV)
39630101 1 µg

RLN3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
LDH-D (H-10) HRP
sc-374128 HRP 200 µg/mL

LDH-D (H-10) HRP

Sign In for Pricing
View Details
Sm N Lentiviral Activation Particles (m2)
sc-423064-LAC-2 200 µL

Sm N Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Human FOLH1 Pre-designed siRNA Set B
SI005798B 1 Each

Human FOLH1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
ATF2 (Ab-69 or 51) Antibody
MBS7131889-01 0.1 mL

ATF2 (Ab-69 or 51) Antibody

Sign In for Pricing
View Details