Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EVC Peptide - N-terminal region

EVC Peptide - N-terminal region

Product Specifications

Product Name Alternative

EVC1, EVCL, DWF-1

UniProt

P57679

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EVC Rabbit Polyclonal Antibody (orb55773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001293019.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CRAGRQRTRHQKDDTQNLLKNLESNAQTPSETGSPSRRRKREVQMSKDKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Chicken IgY (H+L) - 60nm Gold NanoUrchins
GUAC-60-23-10 0.5 mL

Anti-Chicken IgY (H+L) - 60nm Gold NanoUrchins

Sign In for Pricing
View Details
ZMAT4 (Zinc Finger Matrin-type Protein 4) (MaxLight 550)
135581-ML550 100 µL

ZMAT4 (Zinc Finger Matrin-type Protein 4) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-STAT3 (Tyr705) Rabbit Polyuclonal Antibody
E10G20280 100 µL

Phospho-STAT3 (Tyr705) Rabbit Polyuclonal Antibody

Sign In for Pricing
View Details
Human FSH Matched Antibody Pair Set [ABP-S-052671]
ABP-S-052671 5 Plates

Human FSH Matched Antibody Pair Set [ABP-S-052671]

Sign In for Pricing
View Details
Recombinant Shigella Boydii yaeP Protein (aa 1-66) (strain Sb227)
VAng-Lsx08922-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Boydii yaeP Protein (aa 1-66) (strain Sb227)

Sign In for Pricing
View Details
EMP3 Polyclonal Antibody, HRP Conjugated
A62471-100 100 µL

EMP3 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details