Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CETN2 Peptide - middle region

CETN2 Peptide - middle region

Product Specifications

Product Name Alternative

CALT, CEN2

UniProt

P41208

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CETN2 Rabbit Polyclonal Antibody (orb589146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004335.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEAD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Marstacimab
MBS5823505 Inquire

Marstacimab

Sign In for Pricing
View Details
GlycoBind Binding Buffer - AIA
21510906-2 25 mL

GlycoBind Binding Buffer - AIA

Sign In for Pricing
View Details
STK17A Antibody
MBS9604178-01 0.1 mL

STK17A Antibody

Sign In for Pricing
View Details
STK17A Antibody
MBS9604178-02 0.2 mL

STK17A Antibody

Sign In for Pricing
View Details
STK17A Antibody
MBS9604178-03 5x 0.2 mL

STK17A Antibody

Sign In for Pricing
View Details
GNB5 Antibody - C-terminal region : Biotin (ARP74545_P050-Biotin)
ARP74545_P050-Biotin 100 µL

GNB5 Antibody - C-terminal region : Biotin (ARP74545_P050-Biotin)

Sign In for Pricing
View Details