Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CETN2 Peptide - middle region

CETN2 Peptide - middle region

Product Specifications

Product Name Alternative

CALT, CEN2

UniProt

P41208

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CETN2 Rabbit Polyclonal Antibody (orb589146) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004335.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEAD

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEURL2 Rabbit pAb, AP conjugated
orb2856834 100 µL

NEURL2 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
NAP1L5 (NM_153757) Human Recombinant Protein
TP710360 20 µg

NAP1L5 (NM_153757) Human Recombinant Protein

Sign In for Pricing
View Details
DDX11L1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV722398 1.0 µg DNA

DDX11L1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
MRasberry Escherichia coli Recombinant Protein
PO49254E1 250 µg

MRasberry Escherichia coli Recombinant Protein

Sign In for Pricing
View Details
1,3-Diethylpyrimidine-2,4,6 (1H,3H,5H) -trione
OR24889 1 Each

1,3-Diethylpyrimidine-2,4,6 (1H,3H,5H) -trione

Sign In for Pricing
View Details
Mouse Monoclonal IGDCC3 Antibody (920038) [DyLight 680]
FAB8559Y 0.1 mL

Mouse Monoclonal IGDCC3 Antibody (920038) [DyLight 680]

Sign In for Pricing
View Details