Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AARS2 Peptide - middle region

AARS2 Peptide - middle region

Product Specifications

Product Name Alternative

AARSL, LKENP, COXPD8, MTALARS, MT-ALARS

UniProt

Q5JTZ9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AARS2 Rabbit Polyclonal Antibody (orb589147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065796.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQGVPPTDDSPKYNYSLRPSGSYEFGTCEAQVLQLYTEDGTAVASVGKGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF1R Lentiviral Vector (Rat) (pLenti-GIII-CMV )
24313066 1.0 µg DNA

IGF1R Lentiviral Vector (Rat) (pLenti-GIII-CMV )

Sign In for Pricing
View Details
Human Reticulon 4 (RTN4) ELISA Kit
JL15381-01 48 Tests

Human Reticulon 4 (RTN4) ELISA Kit

Sign In for Pricing
View Details
Human Reticulon 4 (RTN4) ELISA Kit
JL15381-02 96 Tests

Human Reticulon 4 (RTN4) ELISA Kit

Sign In for Pricing
View Details
Rabbit AFGF-1 ELISA Kit
ERTA0755 96 Tests

Rabbit AFGF-1 ELISA Kit

Sign In for Pricing
View Details
Human Coiled coil helix coiled coil helix domain containing protein 7 (CHCHD7) ELISA kit
GTR10438181 96 Well

Human Coiled coil helix coiled coil helix domain containing protein 7 (CHCHD7) ELISA kit

Sign In for Pricing
View Details
Recombinant Human Prostacyclin receptor (PTGIR)
orb2904735-01 20 µg

Recombinant Human Prostacyclin receptor (PTGIR)

Sign In for Pricing
View Details