Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AARS2 Peptide - middle region

AARS2 Peptide - middle region

Product Specifications

Product Name Alternative

AARSL, LKENP, COXPD8, MTALARS, MT-ALARS

UniProt

Q5JTZ9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AARS2 Rabbit Polyclonal Antibody (orb589147) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065796.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQGVPPTDDSPKYNYSLRPSGSYEFGTCEAQVLQLYTEDGTAVASVGKGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abcc9 (NM_011511) Mouse Tagged Lenti ORF Clone
MR223929L4 10 µg

Abcc9 (NM_011511) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SYNG1 rabbit pAb
RA35150-01 50 µL

SYNG1 rabbit pAb

Sign In for Pricing
View Details
SYNG1 rabbit pAb
RA35150-02 100 µL

SYNG1 rabbit pAb

Sign In for Pricing
View Details
Recombinant NUP107 Antibody
RC-5837-01 50 μL

Recombinant NUP107 Antibody

Sign In for Pricing
View Details
Recombinant NUP107 Antibody
RC-5837-02 100 µL

Recombinant NUP107 Antibody

Sign In for Pricing
View Details
Recombinant NUP107 Antibody
RC-5837-03 1 mL

Recombinant NUP107 Antibody

Sign In for Pricing
View Details