Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICB Peptide - N-terminal region

MICB Peptide - N-terminal region

Product Specifications

Product Name Alternative

PERB11.2

UniProt

Q29980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MICB Rabbit Polyclonal Antibody (orb584647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005922

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDGQPFLRYDRQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS4 Adenovirus (Rat)
11362056 1.0 mL

ADAMTS4 Adenovirus (Rat)

Sign In for Pricing
View Details
O14K1 Polyclonal Antibody
ABP59589-01 30 µL

O14K1 Polyclonal Antibody

Sign In for Pricing
View Details
O14K1 Polyclonal Antibody
ABP59589-02 100 µL

O14K1 Polyclonal Antibody

Sign In for Pricing
View Details
O14K1 Polyclonal Antibody
ABP59589-03 200 µL

O14K1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Tyrosine Hydroxylase (Phospho-Ser40)
Y011212 100 µg

Anti-Tyrosine Hydroxylase (Phospho-Ser40)

Sign In for Pricing
View Details
DRP1 (PT0086R) PT® Rabbit mAb
YM8049-01 40 µL

DRP1 (PT0086R) PT® Rabbit mAb

Sign In for Pricing
View Details