Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICB Peptide - N-terminal region

MICB Peptide - N-terminal region

Product Specifications

Product Name Alternative

PERB11.2

UniProt

Q29980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MICB Rabbit Polyclonal Antibody (orb584647) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005922

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDGQPFLRYDRQKRRAKPQGQWAENVLGAKTWDTETEDLTENGQDLRRTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat KAT5 shRNA Plasmid
abx987844-01 150 µg

Rat KAT5 shRNA Plasmid

Sign In for Pricing
View Details
Rat KAT5 shRNA Plasmid
abx987844-02 300 µg

Rat KAT5 shRNA Plasmid

Sign In for Pricing
View Details
Droxicam
sc-498446 1 g

Droxicam

Sign In for Pricing
View Details
Human MAP3K12 Pre-designed siRNA Set B
SI009199B 1 Each

Human MAP3K12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse ZHX1 shRNA Plasmid
abx973482-01 150 µg

Mouse ZHX1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse ZHX1 shRNA Plasmid
abx973482-02 300 µg

Mouse ZHX1 shRNA Plasmid

Sign In for Pricing
View Details