Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP19 Peptide - middle region

USP19 Peptide - middle region

Product Specifications

Product Name Alternative

ZMYND9

UniProt

O94966

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP19 Rabbit Polyclonal Antibody (orb589350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001186089.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-b-Hydroxyethylmorpholine 95%
H12230-01 250 g

N-b-Hydroxyethylmorpholine 95%

Sign In for Pricing
View Details
N-b-Hydroxyethylmorpholine 95%
H12230-02 1000 g

N-b-Hydroxyethylmorpholine 95%

Sign In for Pricing
View Details
N-b-Hydroxyethylmorpholine 95%
H12230-03 5000 g

N-b-Hydroxyethylmorpholine 95%

Sign In for Pricing
View Details
DNAJC9 Rabbit Polyclonal Antibody (FITC)
orb465490 100 µL

DNAJC9 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Gaa1 Antibody
orb854211 2 mg

Gaa1 Antibody

Sign In for Pricing
View Details
3-Bromo-5-iodotoluene
424475-01 100 mg

3-Bromo-5-iodotoluene

Sign In for Pricing
View Details