USP19 Peptide - middle region
USP19 Peptide - middle region
Product Specifications
Product Name Alternative
ZMYND9
UniProt
O94966
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with USP19 Rabbit Polyclonal Antibody (orb589350) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001186089.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRPDEVVAE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1949446-01 48 Tests
Human Colon Cancer Specific Antigen-4 (CCSA-4) ELISA Kit
Sign In for Pricing
View Details orb1949446-02 96 Tests
Human Colon Cancer Specific Antigen-4 (CCSA-4) ELISA Kit
Sign In for Pricing
View Details 
MBS6367686-01 0.1 mL
ZNF768, NT (ZNF768, Zinc finger protein 768) (MaxLight 490)
Sign In for Pricing
View Details MBS6367686-02 5x 0.1 mL
ZNF768, NT (ZNF768, Zinc finger protein 768) (MaxLight 490)
Sign In for Pricing
View Details 