Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DRB1 Peptide - middle region

HLA-DRB1 Peptide - middle region

Product Specifications

Product Name Alternative

SS1, DRB1, DRw10, HLA-DRB, HLA-DR1B

UniProt

P04229

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DRB1 Rabbit Polyclonal Antibody (orb589509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002115.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin-6 (IL-6, IL6)
217462 250 µg

Interleukin-6 (IL-6, IL6)

Sign In for Pricing
View Details
Anti-Beta Amyloid (Phospho-T743) Antibody
CPA3131-01 30 µL

Anti-Beta Amyloid (Phospho-T743) Antibody

Sign In for Pricing
View Details
Anti-Beta Amyloid (Phospho-T743) Antibody
CPA3131-02 50 μL

Anti-Beta Amyloid (Phospho-T743) Antibody

Sign In for Pricing
View Details
Anti-Beta Amyloid (Phospho-T743) Antibody
CPA3131-03 100 µL

Anti-Beta Amyloid (Phospho-T743) Antibody

Sign In for Pricing
View Details
Anti-Beta Amyloid (Phospho-T743) Antibody
CPA3131-04 200 µL

Anti-Beta Amyloid (Phospho-T743) Antibody

Sign In for Pricing
View Details
Mouse Nuclear pore glycoprotein p62 (NUP62) ELISA Kit
201-02-3715 96 Tests

Mouse Nuclear pore glycoprotein p62 (NUP62) ELISA Kit

Sign In for Pricing
View Details