Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DRB1 Peptide - middle region

HLA-DRB1 Peptide - middle region

Product Specifications

Product Name Alternative

SS1, DRB1, DRw10, HLA-DRB, HLA-DR1B

UniProt

P04229

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DRB1 Rabbit Polyclonal Antibody (orb589509) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002115.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGV

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM123 antibody
70R-7328 100 µL

TMEM123 antibody

Sign In for Pricing
View Details
GPR15 Antibody (YA4053, Mouse)
HY-P84356-01 10 µL

GPR15 Antibody (YA4053, Mouse)

Sign In for Pricing
View Details
GPR15 Antibody (YA4053, Mouse)
HY-P84356-02 50 μL

GPR15 Antibody (YA4053, Mouse)

Sign In for Pricing
View Details
GPR15 Antibody (YA4053, Mouse)
HY-P84356-03 100 µL

GPR15 Antibody (YA4053, Mouse)

Sign In for Pricing
View Details
a-CGRP (23-37) (human)
H-8895.0005 5.0mg

a-CGRP (23-37) (human)

Sign In for Pricing
View Details
Polyclonal Antibody to FK506 Binding Protein 3 (FKBP3)
TRV-0045174-01 20 µL

Polyclonal Antibody to FK506 Binding Protein 3 (FKBP3)

Sign In for Pricing
View Details