ZNF346 Peptide - middle region
ZNF346 Peptide - middle region
Product Specifications
Product Name Alternative
JAZ, Zfp346
UniProt
Q9UL40
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF346 Rabbit Polyclonal Antibody (orb589510) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001295142.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMET
More Discoveries
Explore Other Products
Browse additional items from our catalog
496967 100 µL
ZSCAN16 (Zinc Finger and SCAN Domain-containing Protein 16, Zinc Finger and SCAN Domain-containing 16)
Sign In for Pricing
View Details 
MBS1117331-01 0.02 mg (E-Coli)
Recombinant Synechocystis sp. Uncharacterized protein slr1300 (slr1300)
Sign In for Pricing
View Details 
MBS1117331-02 0.02 mg (Yeast)
Recombinant Synechocystis sp. Uncharacterized protein slr1300 (slr1300)
Sign In for Pricing
View Details MBS1117331-03 0.1 mg (E-Coli)
Recombinant Synechocystis sp. Uncharacterized protein slr1300 (slr1300)
Sign In for Pricing
View Details MBS1117331-04 0.1 mg (Yeast)
Recombinant Synechocystis sp. Uncharacterized protein slr1300 (slr1300)
Sign In for Pricing
View Details 
MBS1117331-05 0.02 mg (Baculovirus)
Recombinant Synechocystis sp. Uncharacterized protein slr1300 (slr1300)
Sign In for Pricing
View Details