NDUFAF1 Peptide - middle region
NDUFAF1 Peptide - middle region
Product Specifications
Product Name Alternative
CGI65, CIA30, CGI-65
UniProt
Q9Y375
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NDUFAF1 Rabbit Polyclonal Antibody (orb589513) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_057097.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KASSQRKTEGDLQGDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLL
More Discoveries
Explore Other Products
Browse additional items from our catalog
MR220895L3V 200 µL
Tfdp2 (NM_178667) Mouse Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
GTR15277591 1 Vial
Lentiviral mouse Fbxo11 shRNA (UAS) - Lentiviral mouse Fbxo11 shRNA (UAS) plasmid
Sign In for Pricing
View Details 
490941 100 µL
RPS6KB1 (Ribosomal Protein S6 Kinase Beta-1, Ribosomal Protein S6 Kinase, 70kD, Polypeptide 1)
Sign In for Pricing
View Details 