RMDN2 Peptide - middle region
RMDN2 Peptide - middle region
Product Specifications
Product Name Alternative
RMD2, RMD4, RMD-2, FAM82A, BLOCK18, FAM82A1, PRO34163, PYST9371
UniProt
Q96LZ7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RMDN2 Rabbit Polyclonal Antibody (orb589528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001164262.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IEFMWRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHL
More Discoveries
Explore Other Products
Browse additional items from our catalog
