CCSAP Peptide - middle region
CCSAP Peptide - middle region
Product Specifications
Product Name Alternative
CSAP, C1orf96
UniProt
Q6IQ19
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCSAP Rabbit Polyclonal Antibody (orb589533) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_660300.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2101662-01 5x 96 Tests
Rat Docking Protein 1 (DOK1) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2101662-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Rat Docking Protein 1 (DOK1) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2101662-03 10x 96 Tests
Rat Docking Protein 1 (DOK1) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2101662-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)
Rat Docking Protein 1 (DOK1) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details