Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCSAP Peptide - middle region

CCSAP Peptide - middle region

Product Specifications

Product Name Alternative

CSAP, C1orf96

UniProt

Q6IQ19

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCSAP Rabbit Polyclonal Antibody (orb589533) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_660300.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCE1 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2491463 100 µL

SCE1 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
ARNT2 Recombinant Protein (Mouse)
RP117239 100 µg

ARNT2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti-ATAD2 Polyclonal Antibody
PTX20531 100 µg

Anti-ATAD2 Polyclonal Antibody

Sign In for Pricing
View Details
Synaptophysin Rabbit Monoclonal Antibody
orb2989164-01 30 µL

Synaptophysin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Synaptophysin Rabbit Monoclonal Antibody
orb2989164-02 50 µL

Synaptophysin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Synaptophysin Rabbit Monoclonal Antibody
orb2989164-03 100 µL

Synaptophysin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details