Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERAC1 Peptide - C-terminal region

SERAC1 Peptide - C-terminal region

Product Specifications

UniProt

Q96JX3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERAC1 Rabbit Polyclonal Antibody (orb584762) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

AAH28594.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVRKVLATSAKILRNPFADPFSTVDIEDHECAVWLLLRKSKSDDKTTRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1RL1 Protein (C-His, Human)
P525815 100 µg

IL1RL1 Protein (C-His, Human)

Sign In for Pricing
View Details
Lentiviral mouse Galnt1 shRNA (UAS) - Lentiviral mouse Galnt1 shRNA (UAS) plasmid
GTR15202435 1 Vial

Lentiviral mouse Galnt1 shRNA (UAS) - Lentiviral mouse Galnt1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Fibroblast Growth Factor 22 (FGF22) ELISA Kit
MBS2614115-01 48 Well

Rabbit Fibroblast Growth Factor 22 (FGF22) ELISA Kit

Sign In for Pricing
View Details
Rabbit Fibroblast Growth Factor 22 (FGF22) ELISA Kit
MBS2614115-02 96 Well

Rabbit Fibroblast Growth Factor 22 (FGF22) ELISA Kit

Sign In for Pricing
View Details
Rabbit Fibroblast Growth Factor 22 (FGF22) ELISA Kit
MBS2614115-03 5x 96 Well

Rabbit Fibroblast Growth Factor 22 (FGF22) ELISA Kit

Sign In for Pricing
View Details
Rabbit Fibroblast Growth Factor 22 (FGF22) ELISA Kit
MBS2614115-04 10x 96 Well

Rabbit Fibroblast Growth Factor 22 (FGF22) ELISA Kit

Sign In for Pricing
View Details