Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SORCS2 Peptide - C-terminal region

SORCS2 Peptide - C-terminal region

Product Specifications

UniProt

Q96PQ0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SORCS2 Rabbit Polyclonal Antibody (orb589420) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_065828.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAV2 Rabbit Polyclonal Antibody
AP20506PU-N 100 µg

VAV2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Diclofenac Acid
TRC-D436465-1G 1 g

Diclofenac Acid

Sign In for Pricing
View Details
Human SLC36A1 activation kit by CRISPRa
GA116468 1 Kit

Human SLC36A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Polystyrene A COOH
HA140003.100G 100 g

Polystyrene A COOH

Sign In for Pricing
View Details
p47-phox Recombinant Mouse Monoclonal Antibody [A6B10-R]
HA601264 100 µL

p47-phox Recombinant Mouse Monoclonal Antibody [A6B10-R]

Sign In for Pricing
View Details
Rbp4 (BC031809) Mouse Tagged ORF Clone
MG202052 10 µg

Rbp4 (BC031809) Mouse Tagged ORF Clone

Sign In for Pricing
View Details