SORCS2 Peptide - C-terminal region
SORCS2 Peptide - C-terminal region
Product Specifications
UniProt
Q96PQ0
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SORCS2 Rabbit Polyclonal Antibody (orb589420) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_065828.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Alas1 Recombinant Rabbit Monoclonal Antibody [SA70-04]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81733/imageurl/et1601-26.webp)
ET1601-26 100 µL
Alas1 Recombinant Rabbit Monoclonal Antibody [SA70-04]
Sign In for Pricing
View Details 
![PE Anti-Human CD172a/b Antibody[SE5A5]](https://cdn.genprice.uk/products/763/68dd14a1061270361e7d0806/imageurl/an00317d.webp)
