RASAL3 Peptide - C-terminal region
RASAL3 Peptide - C-terminal region
Product Specifications
UniProt
Q86YV0
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RASAL3 Rabbit Polyclonal Antibody (orb589424) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_075055.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PRKPSVPWQRQMDQPQDRNQALGTHRPVNKLAELQCEVAALREEQKVLSR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![IFITM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D11]](https://cdn.genprice.uk/products/937/68dd1b85061270361ea20518/imageurl/ta811628bm.webp)
TA811628BM 100 µL
IFITM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6D11]
Sign In for Pricing
View Details 
