Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD2 Peptide - middle region

CHCHD2 Peptide - middle region

Product Specifications

Product Name Alternative

MNRR1, NS2TP, PARK22, C7orf17

UniProt

Q9Y6H1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHCHD2 Rabbit Polyclonal Antibody (orb589243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057223

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleophosmin (ABT210) Antibody
V0420-01 20 µL

Nucleophosmin (ABT210) Antibody

Sign In for Pricing
View Details
Nucleophosmin (ABT210) Antibody
V0420-02 50 μL

Nucleophosmin (ABT210) Antibody

Sign In for Pricing
View Details
Nucleophosmin (ABT210) Antibody
V0420-03 100 µL

Nucleophosmin (ABT210) Antibody

Sign In for Pricing
View Details
Nucleophosmin (ABT210) Antibody
V0420-04 200 µL

Nucleophosmin (ABT210) Antibody

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase 1 Antibody (8N840)
TMAH-00131-01 50 μL

Anti-Carbonic Anhydrase 1 Antibody (8N840)

Sign In for Pricing
View Details
Anti-Carbonic Anhydrase 1 Antibody (8N840)
TMAH-00131-02 100 µL

Anti-Carbonic Anhydrase 1 Antibody (8N840)

Sign In for Pricing
View Details