CHCHD2 Peptide - middle region
CHCHD2 Peptide - middle region
Product Specifications
Product Name Alternative
MNRR1, NS2TP, PARK22, C7orf17
UniProt
Q9Y6H1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CHCHD2 Rabbit Polyclonal Antibody (orb589243) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_057223
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-74418JF646 0.1 mL
Mouse Monoclonal Syntenin 1 Antibody (OTI2H6) [Janelia Fluor 646]
Sign In for Pricing
View Details 
RD-TAF12-Mu-48Tests 48 Tests
Mouse TATA Box Binding Protein Associated Factor 12 (TAF12) ELISA Kit
Sign In for Pricing
View Details 
MBS7028487-01 0.02 mg
Recombinant Rhodobacter sphaeroides Sensor histidine kinase regB (regB)
Sign In for Pricing
View Details MBS7028487-02 0.1 mg
Recombinant Rhodobacter sphaeroides Sensor histidine kinase regB (regB)
Sign In for Pricing
View Details