Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP10 Peptide - middle region

USP10 Peptide - middle region

Product Specifications

Product Name Alternative

UBPO

UniProt

Q14694

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP10 Rabbit Polyclonal Antibody (orb588385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001259004.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chonglou Saponin VII
C14004-01 1 mg

Chonglou Saponin VII

Sign In for Pricing
View Details
Chonglou Saponin VII
C14004-02 5 mg

Chonglou Saponin VII

Sign In for Pricing
View Details
mmu-miR-7240-3p miRNA Antagomir
MBS8320264-01 10 nmol

mmu-miR-7240-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-7240-3p miRNA Antagomir
MBS8320264-02 20 nmol

mmu-miR-7240-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-7240-3p miRNA Antagomir
MBS8320264-03 5x 20 nmol

mmu-miR-7240-3p miRNA Antagomir

Sign In for Pricing
View Details
IGF2BP3 Knockout T47D Polyclonal Cells
ARG36803 1 Million

IGF2BP3 Knockout T47D Polyclonal Cells

Sign In for Pricing
View Details