Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP10 Peptide - middle region

USP10 Peptide - middle region

Product Specifications

Product Name Alternative

UBPO

UniProt

Q14694

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP10 Rabbit Polyclonal Antibody (orb588385) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001259004.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SECTM1 Rabbit Polyclonal Antibody (BF594)
orb2554385 100 µL

SECTM1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Human Angiomotin-like protein 2 Protein
orb1475466-01 50 µg

Human Angiomotin-like protein 2 Protein

Sign In for Pricing
View Details
Human Angiomotin-like protein 2 Protein
orb1475466-02 500 µg

Human Angiomotin-like protein 2 Protein

Sign In for Pricing
View Details
Mouse Connective Tissue Growth Factor CLIA Kit
IMSCTGFKTC 1 Each

Mouse Connective Tissue Growth Factor CLIA Kit

Sign In for Pricing
View Details
ATG4C Antibody, Biotin conjugated
MBS7050782-01 0.05 mg

ATG4C Antibody, Biotin conjugated

Sign In for Pricing
View Details
ATG4C Antibody, Biotin conjugated
MBS7050782-02 0.1 mg

ATG4C Antibody, Biotin conjugated

Sign In for Pricing
View Details