WIPF1 Peptide - middle region
WIPF1 Peptide - middle region
Product Specifications
Product Name Alternative
WIP, WAS2, PRPL-2, WASPIP
UniProt
O43516
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WIPF1 Rabbit Polyclonal Antibody (orb588389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001070737.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1361512-01 0.02 mg (E-Coli)
Recombinant Mesorhizobium sp. UPF0386 protein Meso_1721 (Meso_1721)
Sign In for Pricing
View Details MBS1361512-02 0.1 mg (E-Coli)
Recombinant Mesorhizobium sp. UPF0386 protein Meso_1721 (Meso_1721)
Sign In for Pricing
View Details MBS1361512-03 0.02 mg (Yeast)
Recombinant Mesorhizobium sp. UPF0386 protein Meso_1721 (Meso_1721)
Sign In for Pricing
View Details MBS1361512-04 0.1 mg (Yeast)
Recombinant Mesorhizobium sp. UPF0386 protein Meso_1721 (Meso_1721)
Sign In for Pricing
View Details MBS1361512-05 0.02 mg (Baculovirus)
Recombinant Mesorhizobium sp. UPF0386 protein Meso_1721 (Meso_1721)
Sign In for Pricing
View Details