Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WIPI2 Peptide - N-terminal region

WIPI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Atg21, ATG18B, CGI-50, WIPI-2

UniProt

Q9Y4P8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WIPI2 Rabbit Polyclonal Antibody (orb588390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001028690.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB14, NT
378486 200 µL

GRB14, NT

Sign In for Pricing
View Details
TUBGCP3 Adenovirus (Mouse)
48832054 1.0 mL

TUBGCP3 Adenovirus (Mouse)

Sign In for Pricing
View Details
Guinea Pig 3-Nitrotyrosine,3-NT ELISA KIT
E0096Gp-01 48 Well

Guinea Pig 3-Nitrotyrosine,3-NT ELISA KIT

Sign In for Pricing
View Details
Guinea Pig 3-Nitrotyrosine,3-NT ELISA KIT
E0096Gp-02 96 Well

Guinea Pig 3-Nitrotyrosine,3-NT ELISA KIT

Sign In for Pricing
View Details
Guinea Pig 3-Nitrotyrosine,3-NT ELISA KIT
E0096Gp-03 5x 96 Tests

Guinea Pig 3-Nitrotyrosine,3-NT ELISA KIT

Sign In for Pricing
View Details
Guinea Pig 3-Nitrotyrosine,3-NT ELISA KIT
E0096Gp-04 10x 96 Tests

Guinea Pig 3-Nitrotyrosine,3-NT ELISA KIT

Sign In for Pricing
View Details