Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WIPI2 Peptide - N-terminal region

WIPI2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Atg21, ATG18B, CGI-50, WIPI-2

UniProt

Q9Y4P8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WIPI2 Rabbit Polyclonal Antibody (orb588390) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001028690.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASQSGEAGAGQLLFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caenorhabditis Elegans dom-3 Protein (aa 1-393)
VAng-Ly3294-1mgEcoli 1 mg (E. coli)

Recombinant Caenorhabditis Elegans dom-3 Protein (aa 1-393)

Sign In for Pricing
View Details
LgA Antibody (Center) (Ascites)
E45M02442G-4 50 µL

LgA Antibody (Center) (Ascites)

Sign In for Pricing
View Details
Human Von Willebrand Factor A Domain Containing Protein 3B (VWA3B) ELISA Kit
MBS9393166-01 48 Well

Human Von Willebrand Factor A Domain Containing Protein 3B (VWA3B) ELISA Kit

Sign In for Pricing
View Details
Human Von Willebrand Factor A Domain Containing Protein 3B (VWA3B) ELISA Kit
MBS9393166-02 96 Well

Human Von Willebrand Factor A Domain Containing Protein 3B (VWA3B) ELISA Kit

Sign In for Pricing
View Details
Human Von Willebrand Factor A Domain Containing Protein 3B (VWA3B) ELISA Kit
MBS9393166-03 5x 96 Well

Human Von Willebrand Factor A Domain Containing Protein 3B (VWA3B) ELISA Kit

Sign In for Pricing
View Details
Human Von Willebrand Factor A Domain Containing Protein 3B (VWA3B) ELISA Kit
MBS9393166-04 10x 96 Well

Human Von Willebrand Factor A Domain Containing Protein 3B (VWA3B) ELISA Kit

Sign In for Pricing
View Details