Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRIT1 Peptide - C-terminal region

KRIT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAM, CCM1

UniProt

O00522

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRIT1 Rabbit Polyclonal Antibody (orb588398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

AAB58582

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNRILHEYKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant NPC2 Antibody
RC-5827-01 50 μL

Recombinant NPC2 Antibody

Sign In for Pricing
View Details
Recombinant NPC2 Antibody
RC-5827-02 100 µL

Recombinant NPC2 Antibody

Sign In for Pricing
View Details
Recombinant NPC2 Antibody
RC-5827-03 1 mL

Recombinant NPC2 Antibody

Sign In for Pricing
View Details
Zc3h6 Mouse Gene Knockout Kit (CRISPR)
KN519646 1 Kit

Zc3h6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human sIgA (Secretory Immunoglobulin A) CLIA Kit
E-CL-H0830-01 24 Tests

Human sIgA (Secretory Immunoglobulin A) CLIA Kit

Sign In for Pricing
View Details
Human sIgA (Secretory Immunoglobulin A) CLIA Kit
E-CL-H0830-02 48 Tests

Human sIgA (Secretory Immunoglobulin A) CLIA Kit

Sign In for Pricing
View Details