Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRIT1 Peptide - C-terminal region

KRIT1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAM, CCM1

UniProt

O00522

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRIT1 Rabbit Polyclonal Antibody (orb588398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

AAB58582

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNRILHEYKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vimentin Recombinant Rabbit monoclonal Antibody
HA750215 100 µL

Vimentin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
DOK3 Mouse Monoclonal Antibody [Clone ID: OTI2B11]
CF813139 100 µg

DOK3 Mouse Monoclonal Antibody [Clone ID: OTI2B11]

Sign In for Pricing
View Details
Sumo 1 (SUMO1) Mouse Monoclonal Antibody [Clone ID: SM1/495]
AM50308PU-T 20 µg

Sumo 1 (SUMO1) Mouse Monoclonal Antibody [Clone ID: SM1/495]

Sign In for Pricing
View Details
XTP3TPA (DCTPP1) Human Gene Knockout Kit (CRISPR)
KN401727 1 Kit

XTP3TPA (DCTPP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein (mFc Tag)
PKSR030479-01 50 µg

Recombinant SARS-CoV-2 S1 Protein (mFc Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein (mFc Tag)
PKSR030479-02 1 mg

Recombinant SARS-CoV-2 S1 Protein (mFc Tag)

Sign In for Pricing
View Details