SRSF1 Peptide - middle region
SRSF1 Peptide - middle region
Product Specifications
Product Name Alternative
ASF, SF2, SFRS1, SF2p33, SRp30a
UniProt
Q07955
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SRSF1 Rabbit Polyclonal Antibody (orb588433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
EAW94488.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E5403 96 Tests
Kinesin-Like protein KIF16B (KIF16B) Human ELISA Kit
Sign In for Pricing
View Details 058389-01 10 µg
Eukaryotic Chemokine C-X-C-Motif Ligand 15 (CXCL15), Recombinant, Mouse
Sign In for Pricing
View Details 058389-02 50 µg
Eukaryotic Chemokine C-X-C-Motif Ligand 15 (CXCL15), Recombinant, Mouse
Sign In for Pricing
View Details 058389-03 100 µg
Eukaryotic Chemokine C-X-C-Motif Ligand 15 (CXCL15), Recombinant, Mouse
Sign In for Pricing
View Details