SRSF1 Peptide - middle region
SRSF1 Peptide - middle region
Product Specifications
Product Name Alternative
ASF, SF2, SFRS1, SF2p33, SRp30a
UniProt
Q07955
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SRSF1 Rabbit Polyclonal Antibody (orb588433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
EAW94488.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2072381-01 0.1 mL
APC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acyltransferase 1 (ACAA1)
Sign In for Pricing
View Details MBS2072381-02 0.2 mL
APC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acyltransferase 1 (ACAA1)
Sign In for Pricing
View Details MBS2072381-03 0.5 mL
APC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acyltransferase 1 (ACAA1)
Sign In for Pricing
View Details MBS2072381-04 1 mL
APC-Linked Polyclonal Antibody to Acetyl Coenzyme A Acyltransferase 1 (ACAA1)
Sign In for Pricing
View Details