Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4B Peptide - N-terminal region

PLA2G4B Peptide - N-terminal region

Product Specifications

Product Name Alternative

HsT16992, cPLA2-beta

UniProt

P0C869

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLA2G4B Rabbit Polyclonal Antibody (orb588883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLWALINEALLHDEPHDHKLSDQREALSHGQNPLPIYCALNTKGQSLTTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican-3 (GPC3/863 + 1G12), CF555 conjugate, 0.1mg/mL
BNC550864-100 1x 100 µL

Glypican-3 (GPC3/863 + 1G12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
THAP8 Mouse Monoclonal Antibody [Clone ID: OTI4H9]
CF811426 100 µg

THAP8 Mouse Monoclonal Antibody [Clone ID: OTI4H9]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS636946 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
RFPL4A Human Gene Knockout Kit (CRISPR)
KN427429 1 Kit

RFPL4A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Saliva/Swab RNA Purification Kit Dx
Dx69100 50 Preparations

Saliva/Swab RNA Purification Kit Dx

Sign In for Pricing
View Details
Synaptophysin (Neuroendocrine Marker) (SYP/3551), CF594 conjugate, 0.1mg/mL
BNC943551-100 1x 100 µL

Synaptophysin (Neuroendocrine Marker) (SYP/3551), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details