PLA2G4B Peptide - N-terminal region
PLA2G4B Peptide - N-terminal region
Product Specifications
Product Name Alternative
HsT16992, cPLA2-beta
UniProt
P0C869
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLA2G4B Rabbit Polyclonal Antibody (orb588883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLWALINEALLHDEPHDHKLSDQREALSHGQNPLPIYCALNTKGQSLTTF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CD105 (ENG) Mouse Monoclonal Antibody [Clone ID: 3A9]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fbe8e/imageurl/am06633su-n.webp)
AM06633SU-N 100 µL
CD105 (ENG) Mouse Monoclonal Antibody [Clone ID: 3A9]
Sign In for Pricing
View Details 
BNC683491-100 1x 100 µL
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3491), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Telethonin (TCAP) Mouse Monoclonal Antibody [Clone ID: OTI11H10]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908455/imageurl/cf808419.webp)
CF808419 100 µg
Telethonin (TCAP) Mouse Monoclonal Antibody [Clone ID: OTI11H10]
Sign In for Pricing
View Details 
AP02236SU-S 20 µL
Thymosin beta 4 (TMSB4X) (38-43) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 