DMTN Peptide - middle region
DMTN Peptide - middle region
Product Specifications
Product Name Alternative
DMT, EPB49
UniProt
Q08495
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DMTN Rabbit Polyclonal Antibody (orb55804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001107607.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS520433-01 0.1 mg
Anti-Rat T cells (pan) FITC (Clone OX-52) (mouse IgG2a)
Sign In for Pricing
View Details MBS520433-02 0.5 mg
Anti-Rat T cells (pan) FITC (Clone OX-52) (mouse IgG2a)
Sign In for Pricing
View Details MBS520433-03 5x 0.5 mg
Anti-Rat T cells (pan) FITC (Clone OX-52) (mouse IgG2a)
Sign In for Pricing
View Details 