Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMTN Peptide - middle region

DMTN Peptide - middle region

Product Specifications

Product Name Alternative

DMT, EPB49

UniProt

Q08495

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMTN Rabbit Polyclonal Antibody (orb55804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001107607.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Crystallin Gamma S (CRYgS) ELISA Kit-Sandwich
EK6F545-01 48 Test

Mouse Crystallin Gamma S (CRYgS) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Crystallin Gamma S (CRYgS) ELISA Kit-Sandwich
EK6F545-02 96 Tests

Mouse Crystallin Gamma S (CRYgS) ELISA Kit-Sandwich

Sign In for Pricing
View Details
TBC1D7 Human Over-expression Lysate
orb1340423 100 µg

TBC1D7 Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-DHODH Antibody Picoband® (monoclonal, 4E3) Fluoro550 Conjugated
M04035-Fluoro550 100 µg/Vial

Anti-DHODH Antibody Picoband® (monoclonal, 4E3) Fluoro550 Conjugated

Sign In for Pricing
View Details
Beaker, Tall Form with Spout
G2060480/3A 1 Each

Beaker, Tall Form with Spout

Sign In for Pricing
View Details
TPS17 Antibody
orb797893 2 mg

TPS17 Antibody

Sign In for Pricing
View Details