Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UPK3A Peptide - N-terminal region

UPK3A Peptide - N-terminal region

Product Specifications

Product Name Alternative

UP3A, UPK3, UPIII, UPIIIA

UniProt

O75631

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UPK3A Rabbit Polyclonal Antibody (orb589446) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001161046.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALGCLRFGSAVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL15 Pre-designed siRNA Set A
SI008258A 1 Each

Human KLHL15 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Acamprosate calcium 500mg
A11308-500 500 mg

Acamprosate calcium 500mg

Sign In for Pricing
View Details
SLC4A3 (NM_201574) Human Tagged Lenti ORF Clone
RC220234L4 10 µg

SLC4A3 (NM_201574) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Serum Amyloid A-4 (SAA4) AssayLite™ Antibody (PerCP Conjugate)
13031-05071 5x 30 µg

Human Serum Amyloid A-4 (SAA4) AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
PRKAG1 & PRKAB2 & PRKAA2 Protein (N-GST & N-His, Human)
P527780 100 µg

PRKAG1 & PRKAB2 & PRKAA2 Protein (N-GST & N-His, Human)

Sign In for Pricing
View Details
CASP1 Protein Vector (Mouse) (pPM-C-HA)
PV161676 500 ng

CASP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details