RNF214 Peptide - middle region
RNF214 Peptide - middle region
Product Specifications
UniProt
Q8ND24
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNF214 Rabbit Polyclonal Antibody (orb589448) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001070707.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TMPMVMPSADPRSLSFPILNPALSQPSQPSSPLPGSHGRNSPGLGSLVSP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV814012 1.0 µg DNA
C16orf14 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 