Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLTP Peptide - N-terminal region

PLTP Peptide - N-terminal region

Product Specifications

Product Name Alternative

BPIFE, HDLCQ9

UniProt

P55058

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLTP Rabbit Polyclonal Antibody (orb589650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001229849.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGHFYYNISE

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRG2 (NM_001388) Human Tagged ORF Clone
RG201753 10 µg

DRG2 (NM_001388) Human Tagged ORF Clone

Sign In for Pricing
View Details
WDR78 siRNA (Mouse)
MBS8206050-01 15 nmol

WDR78 siRNA (Mouse)

Sign In for Pricing
View Details
WDR78 siRNA (Mouse)
MBS8206050-02 30 nmol

WDR78 siRNA (Mouse)

Sign In for Pricing
View Details
WDR78 siRNA (Mouse)
MBS8206050-03 5x 30 nmol

WDR78 siRNA (Mouse)

Sign In for Pricing
View Details
(d (CH2) 51, D-Ile2, Ile4, Arg8, Ala-NH29) -Vasopressin b-Mercapto-b, b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)
FI108861-01 5 mg

(d (CH2) 51, D-Ile2, Ile4, Arg8, Ala-NH29) -Vasopressin b-Mercapto-b, b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)

Sign In for Pricing
View Details
(d (CH2) 51, D-Ile2, Ile4, Arg8, Ala-NH29) -Vasopressin b-Mercapto-b, b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)
FI108861-02 10 mg

(d (CH2) 51, D-Ile2, Ile4, Arg8, Ala-NH29) -Vasopressin b-Mercapto-b, b-cyclopentamethylene-propionyl-D-Ile-Phe-Ile-Asn-Cys-Pro-Arg-Ala-NH2 (Disulfide bond)

Sign In for Pricing
View Details